Loading...
Statistics
Advertisement

³æ‰‡è¯´ç¼¬
www.47po.com/

47po.com

Advertisement
Conversion Technology Metas Server
47po.com is hosted in United States / Walnut . 47po.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Javascript, Number of used javascripts: 0. First javascripts: Number of used analytics tools: 0. Its server type is: nginx.

Technologies in use by 47po.com

Technology

Number of occurences: 3
  • CSS
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 0

Server Type

  • nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - 47po.com

Missing HTTPS protocol.

    Meta - 47po.com

    Number of occurences: 3
    • Name:
      Content: text/html; charset=gb2312
    • Name: robots
      Content: all
    • Name: keywords
      Content: 成人电影,吉吉影音成人电影,第四色,www.av,色五月,饭岛爱种子

    Server / Hosting

    • IP: 104.217.6.3
    • Latitude: 34.01
    • Longitude: -117.85
    • Country: United States
    • City: Walnut

    Rname

    • ns4.577716.com
    • ns2.577716.com
    • ns3.577716.com
    • ns1.577716.com

    Target

    • root.47po.com

    HTTP Header Response

    HTTP/1.1 200 OK Server: nginx Date: Fri, 16 Sep 2016 21:53:55 GMT Content-Type: text/html X-Cache: MISS from s_ub15 Transfer-Encoding: chunked Via: 1.1 s_ub15 (squid/3.5.20) Connection: keep-alive

    DNS

    host: 47po.com
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 104.217.6.3
    host: 47po.com
    1. class: IN
    2. ttl: 600
    3. type: NS
    4. target: ns4.577716.com
    host: 47po.com
    1. class: IN
    2. ttl: 600
    3. type: NS
    4. target: ns2.577716.com
    host: 47po.com
    1. class: IN
    2. ttl: 600
    3. type: NS
    4. target: ns3.577716.com
    host: 47po.com
    1. class: IN
    2. ttl: 600
    3. type: NS
    4. target: ns1.577716.com
    host: 47po.com
    1. class: IN
    2. ttl: 600
    3. type: SOA
    4. mname: ns1.577716.com
    5. rname: root.47po.com
    6. serial: 1997022700
    7. refresh: 28800
    8. retry: 14400
    9. expire: 3600000
    10. minimum-ttl: 86400

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.7po.com, www.4w7po.com, www.w7po.com, www.4q7po.com, www.q7po.com, www.4t7po.com, www.t7po.com, www.4e7po.com, www.e7po.com, www.4r7po.com, www.r7po.com, www.427po.com, www.27po.com, www.4po.com, www.47tpo.com, www.4tpo.com, www.47zpo.com, www.4zpo.com, www.47ypo.com, www.4ypo.com, www.47upo.com, www.4upo.com, www.475po.com, www.45po.com, www.47o.com, www.47pio.com, www.47io.com, www.47pko.com, www.47ko.com, www.47puo.com, www.47uo.com, www.47pjo.com, www.47jo.com, www.47plo.com, www.47lo.com, www.47p.com, www.47pob.com, www.47pb.com, www.47poh.com, www.47ph.com, www.47pog.com, www.47pg.com, www.47poj.com, www.47pj.com, www.47pom.com, www.47pm.com, www.47po .com, www.47p .com, www.47pov.com, www.47pv.com,

    Other websites we recently analyzed

    1. Ãœber uns | cairos-academy
      Germany - 78.47.220.105
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 1
    2. miscmannamagalginknimatnyasvetchargapoleaz
      San Francisco (United States) - 192.0.78.13
      Server software: nginx
      Technology: Skimlinks, CSS, Gravatar, Html, Html5, Javascript, Php, Pingback, Shortcodes, comScore, Wordpress, Twitter Button
      Number of Javascript: 8
      Number of meta tags: 7
    3. ¿Ã‹Ã‚¡ÍõվȺ ÁªÏµQQ£º1785605588
      Kansas City (United States) - 173.208.215.148
      Server software: Microsoft-IIS/6.0
      Technology: Html
      Number of meta tags: 1
    4. Restaurant La Ripaille
      Le restaurant La Ripaille est situé à Arromanches, nous vous proposons une cuisine Normande traditionnelle.
      France - 213.186.33.104
      G Analytics ID: UA-441859-8
      Server software: Apache
      Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 4
    5. Tennessee Career Centers
      Columbia (United States) - 66.211.30.3
      G Analytics ID: UA-39861102-1
      Server software:
      Technology: CSS, Html, Iframe, Javascript, Php, Swf Object, Google Analytics, Facebook Like box
      Number of Javascript: 4
      Number of meta tags: 1
    6. Home | Instant Spark
      Scottsdale (United States) - 173.201.243.1
      Server software: Apache
      Technology: Html
    7. Die Potsdam Lions
      Germany - 212.90.148.98
      Server software: Apache/2.2.31
      Technology: Html, Php
      Number of meta tags: 1
    8. Dorcas Clothing :: Wholesale Clothing
      Dorcas is a fashion wholesaler specializing in women's apparel located in Los Angeles fashion district. We offer the latest fashion at the best quality and price.
      Montréal (Canada) - 184.107.203.99
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery Cycle, jQuery UI, Lightbox, Php
      Number of Javascript: 10
      Number of meta tags: 10
    9. THE NEW MILLIONS
      New York (United States) - 198.185.159.145
      Server software:
      Technology: CSS, Html, Iframe, Javascript, Lightbox, Php, Squarespace
      Number of Javascript: 2
      Number of meta tags: 7
    10. ماشین های اداری امیران
      امیران ماشین
      Iran, Islamic Republic of - 185.8.172.176
      Server software: Apache
      Technology: CSS, Font Awesome, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 3

    Check Other Websites